PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.3717s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 134aa    MW: 15181.9 Da    PI: 6.3525
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.3717s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.34.1e-212282257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         r+R+t+t+ ql++Le+ +++ + +p+ ++++e+A++l    ++te++V++WFqNrRa+ k+
  Bostr.3717s0001.1.p 22 RHRWTPTSMQLQILENIYKEgSGTPNPRRIREIATELsehgQITEKNVYNWFQNRRARSKR 82
                         89*****************99**************************************97 PP

2Wus_type_Homeobox103.11.9e-332184265
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         +r+RWtPt+ Q++iLe++yk+G  tPn ++i++i++eL+e+G+i++kNV++WFQNr+aR+++kq
  Bostr.3717s0001.1.p 21 TRHRWTPTSMQLQILENIYKEGSGTPNPRRIREIATELSEHGQITEKNVYNWFQNRRARSKRKQ 84
                         689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.8031883IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-161887IPR009057Homeodomain-like
SuperFamilySSF466893.42E-191889IPR009057Homeodomain-like
SMARTSM003891.4E-132087IPR001356Homeobox domain
CDDcd000868.46E-152284No hitNo description
PfamPF000469.1E-192282IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MVGGYFDPMV VASSSAHGMS TRHRWTPTSM QLQILENIYK EGSGTPNPRR IREIATELSE  60
HGQITEKNVY NWFQNRRARS KRKQPQTTTM IGQPDDAAVT TEERSYGDSG GFFESYEHIL  120
FLSPDLGIEH LFE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17583RRARSKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0692512e-88AC069251.5 Genomic sequence for Arabidopsis thaliana BAC F2D10 from chromosome I, complete sequence.
GenBankCP0026842e-88CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006306476.18e-82hypothetical protein CARUB_v10012447mg
SwissprotQ9LM843e-74WOX14_ARATH; WUSCHEL-related homeobox 14
TrEMBLR0IAB39e-82R0IAB3_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_10017611e-73(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122111732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.11e-75WUSCHEL related homeobox 14